Protein Info for PGA1_c20140 in Phaeobacter inhibens DSM 17395

Annotation: putative arginine-tRNA-protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF04376: ATE_N" amino acids 17 to 87 (71 residues), 77.1 bits, see alignment E=1e-25 PF04377: ATE_C" amino acids 108 to 230 (123 residues), 134.6 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 84% identical to BPT_RUEST: Aspartate/glutamate leucyltransferase (bpt) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 84% identity to sit:TM1040_0882)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN64 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PGA1_c20140 putative arginine-tRNA-protein transferase (Phaeobacter inhibens DSM 17395)
MRHTLPIAPQFYVTAPQPCPYLADRMERKLFTALQGDGVEQLNNSLSQQGFRRSQNVLYR
PSCSDCSACLSARINVADFKASRGQKRTLRRNSELERRATSPWATEDQYALFRTYLDSRH
ADGGMADMDVFEYAAMIEETPIRSRVVEYNHRETNALTAVSLTDVLEDGLSMVYSFYQPD
LPQNSLGTFMILDHIEIAREAGLPYVYLGYWVPGSAKMGYKAKFTGLEVYHRGAWQPMTD
PDAFDDTAHPLSTDPIAEQVANIHLPDSRNHSR