Protein Info for HP15_1935 in Marinobacter adhaerens HP15

Annotation: UTP-glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 2 to 265 (264 residues), 387.5 bits, see alignment E=1.7e-120 PF00483: NTP_transferase" amino acids 10 to 269 (260 residues), 103.1 bits, see alignment E=9.6e-34

Best Hits

Swiss-Prot: 73% identical to GALU_PSEAE: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 93% identity to maq:Maqu_1672)

MetaCyc: 47% identical to UTP--glucose-1-phosphate uridylyltransferase (Staphylococcus aureus)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ19 at UniProt or InterPro

Protein Sequence (278 amino acids)

>HP15_1935 UTP-glucose-1-phosphate uridylyltransferase (Marinobacter adhaerens HP15)
MIKKCLFPVAGYGTRFLPATKAMPKEILPVVNKPLVQYGVEEAAEAGIHEFGFVTGRGKR
AIEDHFDISYELEQQIAGSGKEELLTSIRELIDHNSFAFTRQNEMKGLGHAILTGRNLVG
DNPFAVVLADDFCIGPDGEDGVLAQMVKLYNQFRCSIVAIEEVPADETHKYGVIAGESMK
DGLYRITDMVEKPAPEDAPSNLAIIGRYILTPDIFEIIEKTPAGKNGEVQITDALLEQAK
NGCVLAYQFKGRRFDCGSIDGFVEATNYVYENIYKKDK