Protein Info for Psest_2017 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF00583: Acetyltransf_1" amino acids 29 to 119 (91 residues), 54.8 bits, see alignment E=1.6e-18 PF13673: Acetyltransf_10" amino acids 39 to 137 (99 residues), 74.4 bits, see alignment E=1.2e-24 PF13508: Acetyltransf_7" amino acids 45 to 121 (77 residues), 49.6 bits, see alignment E=6.4e-17

Best Hits

Swiss-Prot: 33% identical to YYAT_BACSU: Uncharacterized protein YyaT (yyaT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to psa:PST_2308)

Predicted SEED Role

"GNAT family acetyltransferase YjcF" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKP6 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Psest_2017 Predicted acyltransferase (Pseudomonas stutzeri RCH2)
MNSVQVRIADWQQDNAELRRIREAVFIAEQAVPPEQEWDADDADAIHFLALEGDYPIGTA
RLLADGQIGRVAVLRDWRGMNVGDALMRAVIAEAERRGLAEQKLTAQVHATAFYERLGFE
VVSDEFLEAGIPHVDMLRRSH