Protein Info for Psest_2014 in Pseudomonas stutzeri RCH2

Updated annotation (from data): Isocitrate lyase (EC 4.1.3.1)
Rationale: Specifically important for utilizing Sodium butyrate and Tween 20. Automated validation from mutant phenotype: the predicted function (ISOCIT-CLEAV-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: Isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF00463: ICL" amino acids 98 to 270 (173 residues), 71.3 bits, see alignment E=6.4e-24 amino acids 330 to 399 (70 residues), 34.6 bits, see alignment E=8.2e-13 amino acids 429 to 530 (102 residues), 49.7 bits, see alignment E=2.3e-17 PF13714: PEP_mutase" amino acids 174 to 266 (93 residues), 45.1 bits, see alignment E=9.8e-16

Best Hits

Swiss-Prot: 92% identical to ACEA_PSEAE: Isocitrate lyase (PA2634) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 98% identity to psa:PST_2311)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIJ4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Psest_2014 Isocitrate lyase (EC 4.1.3.1) (Pseudomonas stutzeri RCH2)
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEVSEAALG
NGDVVIKREGKLLRPKRLPSNLFQFRAGTGEARCILDCITSLQNGADLLWIETEKPHVGQ
IAAMVDEIRKTIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH