Protein Info for PGA1_c20020 in Phaeobacter inhibens DSM 17395

Annotation: Putative GTPases (G3E family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF07683: CobW_C" amino acids 18 to 97 (80 residues), 57.2 bits, see alignment E=6.4e-20

Best Hits

Predicted SEED Role

"Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXW4 at UniProt or InterPro

Protein Sequence (111 amino acids)

>PGA1_c20020 Putative GTPases (G3E family) (Phaeobacter inhibens DSM 17395)
MCNKAALLQSNPAAGFYSQSWSSQKPFSYASFKSALGALPASVFRAKGVLYCIDFPDTRI
VFQKVGSRLEFRHDGPWRGTPETRLVIIGEDGLDQDGFLQKHMEQSLAARS