Protein Info for HP15_1926 in Marinobacter adhaerens HP15

Annotation: PEP-CTERM locus, polysaccharide deactylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03006: polysaccharide deacetylase family protein, PEP-CTERM locus subfamily" amino acids 43 to 312 (270 residues), 395.5 bits, see alignment E=5.1e-123 PF01522: Polysacc_deac_1" amino acids 67 to 171 (105 residues), 80.3 bits, see alignment E=1.2e-26 PF11959: DUF3473" amino acids 184 to 313 (130 residues), 167.8 bits, see alignment E=1.2e-53

Best Hits

KEGG orthology group: None (inferred from 65% identity to sde:Sde_0139)

Predicted SEED Role

"FIG004655: Polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ10 at UniProt or InterPro

Protein Sequence (333 amino acids)

>HP15_1926 PEP-CTERM locus, polysaccharide deactylase (Marinobacter adhaerens HP15)
MLLKTSGLRLIVIGNYLGENQIIGVSWEGVPMPRPDARSPLHAMSIDVEDYFHVAALSHV
IKPSQWDSLPSRVVQNTERLLELFKQYDVKSTFFVLGWVAERFPDLIRKLSDDGHEIASH
GYSHQLIYNQSREIFREETIRSKKLLEDITGNPVHGYRAASYSITRESLWALDILCEAGF
NWDSSIFPIRHDRYGIPDSPKAPYSIQTESGNVIREFPLTTAKVFGLSVPAAGGGYFRQF
PYPLFRYLFRNASGFGTHPQMFYLHPWEIDPDQPRYNNASWLSRFRHYTNLDQCYGRLET
LLQDFRFGTVSESYNAYDPDESLTRNSQMVRLA