Protein Info for HP15_1925 in Marinobacter adhaerens HP15

Annotation: undecaprenyl-phosphate galactosephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 265 to 291 (27 residues), see Phobius details amino acids 431 to 448 (18 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 5 to 450 (446 residues), 390.3 bits, see alignment E=1.6e-120 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 6 to 452 (447 residues), 500.6 bits, see alignment E=4.7e-154 PF13727: CoA_binding_3" amino acids 51 to 196 (146 residues), 32 bits, see alignment E=1.2e-11 PF02397: Bac_transf" amino acids 263 to 446 (184 residues), 226.2 bits, see alignment E=2.3e-71

Best Hits

Predicted SEED Role

"FIG071646: Sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ09 at UniProt or InterPro

Protein Sequence (452 amino acids)

>HP15_1925 undecaprenyl-phosphate galactosephosphotransferase (Marinobacter adhaerens HP15)
MLGILEFVVLFAVFYLLTLILSFVGVDYAPVHTDILSAFLFALVLSCGTLAMGGYLVMVQ
ESISSLFFRTLVAYCFVGGIGLTILYVMVPAADPGSSNLFWAVMLASLVVVLMRLIFLRI
VDSEQLVRRVVILGAGDFAGGLLAESEQNMRALGVRILGCISDSTDPTVEQEKLLCTPYD
FYEFCRKNRISEIVVAQQERRKAEGGWLPVPDLMECKLRGVEVTSALDFYERELKKAKLA
MVHPSWIVFSEGFKASKSRAFAKRFLDLAISLTLLVVMLPFIVLTALAVFLETGRPILYS
QKRVGMLGREFRIYKFRSMRQDAEKDGKAQWASANDSRVTKVGAFIRNTRLDELPQIYNV
LKGEMSIVGPRPERPEFVSELKEKIPFYDTRHYVKPGLMGWAQLKYPYGASIEDAKGKLE
YDLYYSKNHSLMMDILIMIQTVEVVLLGKGVR