Protein Info for PGA1_c19990 in Phaeobacter inhibens DSM 17395

Annotation: ribosomal RNA large subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 13 to 78 (66 residues), 47.7 bits, E=3.7e-16
• PF10672: Methyltrans_SAM
  • amino acids 187 to 401 (215 residues), 45.8 bits, E=1.7e-15
• PF05175: MTS
  • amino acids 226 to 345 (120 residues), 27.2 bits, E=9.5e-10
• PF13847: Methyltransf_31
  • amino acids 228 to 354 (127 residues), 30.9 bits, E=7.5e-11
• PF03602: Cons_hypoth95
  • amino acids 230 to 312 (83 residues), 34.5 bits, E=6e-12
• PF09445: Methyltransf_15
  • amino acids 232 to 311 (80 residues), 22 bits, E=3.7e-08

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 81% identity to sit:TM1040_0887)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See I7E1R5 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PGA1_c19990 ribosomal RNA large subunit methyltransferase I (Phaeobacter inhibens DSM 17395)
MTASPSAPERARVKLKPKANARALRHGFPWVYANELVTDRRTRKLAPGTLAVLEDDGMTS
MGLVAINPESKIIARMLDTDPAAEINQDWFETRLSRALALREQLYDAPYYRLAHAESDGL
PGVVIDRFGDTCVVQPNAAWAEAHLDALTDALVAVTGVTTVLKNASGRARSLEGLDDVST
TLRGTTPEAPVQVTMNGATYMADLTGGQKTGLFYDQRDNHAFAAKLVKPGAKVLDVFSHV
GGFGLAMLAAGAAEATCVDGSAPALDLAREGAAASDFADRFAARQGDAFEVLTQLAEEGV
QFDVVICDPPAFAPSKQALEAGLRAYERIAKLAAPLVAPGGCLGLCSCSHAADLSRFRNA
SARGIGRGGRRSQLLHTGYAGADHPQLPQLAESGYLKAVFFRLD