Protein Info for PGA1_c19930 in Phaeobacter inhibens DSM 17395

Annotation: agmatinase SpeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 46 to 311 (266 residues), 198.7 bits, E=7.5e-63
• PF00491: Arginase
  • amino acids 47 to 311 (265 residues), 288.2 bits, E=3.6e-90

Best Hits

Swiss-Prot: 54% identical to SPEB_CHRVO: Agmatinase (speB) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 81% identity to sit:TM1040_0938)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• superpathway of polyamine biosynthesis I (8/8 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

See I7EN41 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PGA1_c19930 agmatinase SpeB (Phaeobacter inhibens DSM 17395)
MALEDAKHMIDHAFTREDMKGLSFEITFGGATSFLRRKYTKDLTGVDIAVTGVPFDQAVT
NRPGTRLGPRAIREASCLQSPDEPYGWPHKPLSTLAIADYGDLAFDHADVPAFPAALTDH
IRGILATETASVVLGGDHYISFPILKAYAEKHGPISLLQFDAHTDTWPDDNMDRIDHGTM
FYKAVKMGLVDPKTSVQVGIRTTNDDTLGVNIIDAPTVHDIGPVETAKRIKAILGDRPTY
LTFDIDCLDPAYAPGTGTPVWGGLTSAQASRILREIAGINIKGGDVVEVSPPFDTTGATA
IAGAHVATEIICLLGWNMRDND