Protein Info for HP15_1915 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF13439: Glyco_transf_4" amino acids 17 to 175 (159 residues), 69.2 bits, see alignment E=1.1e-22 PF13579: Glyco_trans_4_4" amino acids 17 to 172 (156 residues), 53.1 bits, see alignment E=1.2e-17 PF13692: Glyco_trans_1_4" amino acids 198 to 334 (137 residues), 103.5 bits, see alignment E=3e-33 PF00534: Glycos_transf_1" amino acids 198 to 348 (151 residues), 112.4 bits, see alignment E=4.5e-36 PF13524: Glyco_trans_1_2" amino acids 286 to 365 (80 residues), 37.6 bits, see alignment E=5.1e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPZ9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HP15_1915 glycosyl transferase, group 1 (Marinobacter adhaerens HP15)
MSQIKVLQFISPSGFYGAERWVLAFANNIDPQRMRCDLAVTRESPNQDLRVADFHPDSAG
QVHYVDMAGRFDIRSVKTLVNIIRKREIDVILTHGYKSDILGLIAGRIAGIRCVSTPHGF
SGNVGFKLKMFIRLGTSILRYFDAVAPLSEELIEDMHRFRVPSSKIRFIRNGVDIKDIDA
TLANPGSREKSEAGIRPIGFVGQLIPRKGLLDLLSAFEGLHEHHQGLELQLIGEGRQRPQ
LEEKCARMKAGQAVKFLGFREDRLELLSKFEMFVMTSSLEGIPRCLMESMAVGVPVVAYD
IPGVDQLIEDGVTGLLVPHGDVCALVEACNKLLVDPELKATLTANARTRVEEVYSARRMA
DEYLELFQQLMSPRNSTVTGGAD