Protein Info for HP15_1913 in Marinobacter adhaerens HP15

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 129 to 149 (21 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 17 to 174 (158 residues), 86.4 bits, see alignment E=6.9e-28 PF13579: Glyco_trans_4_4" amino acids 18 to 171 (154 residues), 54.9 bits, see alignment E=4.1e-18 PF13477: Glyco_trans_4_2" amino acids 52 to 119 (68 residues), 23.5 bits, see alignment E=1.7e-08 PF00534: Glycos_transf_1" amino acids 184 to 345 (162 residues), 137.8 bits, see alignment E=8.6e-44 PF13692: Glyco_trans_1_4" amino acids 196 to 335 (140 residues), 117.3 bits, see alignment E=2e-37 PF13524: Glyco_trans_1_2" amino acids 280 to 363 (84 residues), 34.3 bits, see alignment E=6.7e-12

Best Hits

KEGG orthology group: None (inferred from 45% identity to gag:Glaag_3211)

Predicted SEED Role

"FIG040338: Glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPZ7 at UniProt or InterPro

Protein Sequence (373 amino acids)

>HP15_1913 glycosyltransferase (Marinobacter adhaerens HP15)
MTARSINVLHVTFNMAIGGTEQVINQLVRNSRSCEVNHEIACIDSFIGEIGQSLANEGLP
VFCLSRQPGFDLALVKSLRKRIQQGRFDIVHCHQYTPYVYGWLASFGTGSKVVFTEHGRF
FPDRYRYKALMINPLMALMTPAIIAISGATREALSRYEFIPKAKIKVIYNGIDPLERKEE
QVSKIRSELGIPEKAPVLGTVSRLDQVKNQRMMIDAFAELLEAHPTAVLLMVGDGPERPA
LEKRVADLNIGESVRFTGFINRPAQYLGLMNVFLLSSFTEGTSMTLLEAMSLGIPAVATH
VGGNPEIVVDGQTGFLTENNNKEAFLSAMSKLLENPGLWQACSRLSRERFNENYSINHMA
SQYTTIYHQCRGN