Protein Info for PGA1_c19860 in Phaeobacter inhibens DSM 17395

Annotation: dimethyladenosine transferase KsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 21 to 276 (256 residues), 225.7 bits, see alignment E=3.1e-71 PF00398: RrnaAD" amino acids 21 to 276 (256 residues), 166.5 bits, see alignment E=3.5e-53

Best Hits

Swiss-Prot: 84% identical to RSMA_RUEST: Ribosomal RNA small subunit methyltransferase A (rsmA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 84% identity to sit:TM1040_0944)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRH7 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PGA1_c19860 dimethyladenosine transferase KsgA (Phaeobacter inhibens DSM 17395)
MSAIDSLPPLREVIETHQLLARKSLGQNFLLDLNLTAKIARQAGDLSECDVLEIGPGPGG
LTRGLLAEGARRVLAVEKDSRCIPALAEISDAYPGRLQVIEGDALEVNPLTHLTPPIRIA
ANLPYNVGTELLVRWLTPKAWPPFWQSLTLMFQREVAERIVAVPGSKAYGRLALLAQWRA
DARIVLSLPPEAFSPPPKVHSAVVHLKALEAPRYPADAGTLNKVVAAAFNQRRKMLRASL
KSVSPDIEDHLNAVGIPPTERAEQVGLEAFCALARSLKPLD