Protein Info for PGA1_c19780 in Phaeobacter inhibens DSM 17395

Annotation: clan AA aspartic protease, TIGR02281 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 75 to 192 (118 residues), 116.4 bits, see alignment E=4.3e-38 PF13975: gag-asp_proteas" amino acids 88 to 178 (91 residues), 96 bits, see alignment E=1.6e-31 PF13650: Asp_protease_2" amino acids 88 to 175 (88 residues), 90.7 bits, see alignment E=8.1e-30

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 68% identity to sit:TM1040_0952)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN25 at UniProt or InterPro

Protein Sequence (193 amino acids)

>PGA1_c19780 clan AA aspartic protease, TIGR02281 family (Phaeobacter inhibens DSM 17395)
MDGIETPRLIYLVLLLVAVGSWVFVQNRQGLGKTVQQLAIWAFIFLGVIAGYGLWEDIRS
TVQPQQVVMRDAGRVDVPRARDGHYYLTVDVNDVPVQFLVDTGASAVVLNDEDARRVGLN
PDDLAYLGRARTANGEVRTALAKVDSMSLGGITDRNISLSVNEGQMDQSLLGMDYLQRWS
SIEIRNGSLILTR