Protein Info for PGA1_c19770 in Phaeobacter inhibens DSM 17395

Annotation: membrane protein, MarC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 67 (2 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 3 to 198 (196 residues), 186.1 bits, see alignment E=3.1e-59 PF01914: MarC" amino acids 5 to 199 (195 residues), 200 bits, see alignment E=1.5e-63

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 74% identity to sil:SPO2448)

Predicted SEED Role

"Membrane protein, MarC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXU0 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PGA1_c19770 membrane protein, MarC family (Phaeobacter inhibens DSM 17395)
MDTAFLITSFVTLFVIVDPIGLTPIFLALTQGMTPAQRRAIALRSTVTAAVLLAVFAAFG
EAVLGFAGISMAAFRIAGGVLLFLTALDMLFERRNKRREDRSEEDDFDDPSVFPLAIPLI
AGPGSIATVILLTGQQPGFAGFAMVMGVVFAVLGILLIMCLFSGLFERLLGKTGITVVTR
LLGMLLAALSVQFVLDGLRAFGFAGG