Protein Info for PGA1_c19700 in Phaeobacter inhibens DSM 17395

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 54 to 89 (36 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 268 to 295 (28 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 372 to 389 (18 residues), see Phobius details amino acids 401 to 429 (29 residues), see Phobius details TIGR00815: sulfate permease" amino acids 10 to 553 (544 residues), 456.5 bits, see alignment E=6.1e-141 PF00916: Sulfate_transp" amino acids 23 to 405 (383 residues), 353.5 bits, see alignment E=1.2e-109 PF01740: STAS" amino acids 458 to 564 (107 residues), 65.7 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: None (inferred from 73% identity to dsh:Dshi_2515)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F091 at UniProt or InterPro

Protein Sequence (584 amino acids)

>PGA1_c19700 sulfate transporter (Phaeobacter inhibens DSM 17395)
MPSLLTRYVPLLTWGREYDRLTLTNDLIAAVIVTIMLIPQSLAYALLAGLPPEAGLYASI
VPILLYAVFGTSRALAVGPVAVVSLMTAASLSQITAQGSMGYAVAALSLAALSGAILLAM
GLLRLGFLANFLSHPVIAGFITASGVLIATSQIKHLLGISAEGHTLPELILSLLEHLPQL
NWPTALIGGGATVFLFWVRRGLNPTLRRLGIGARLAGFLTKAGPVAAVVVTTLAVWGLGL
AERGVKIVGAVPQALPPLTLPDLSQDLLAQLLLPAVLISVIGFVESISVAQTLAAKRRQR
IDPDQELIGLGTANLGAAFTGGFPVTGGFSRSVVNFDAGAETPAAGAFTAVGLAIAAVAL
TPLIYFLPKATLAATIITAVLGLVDFSILRKSWGYSKADFAAVLTTIALTLLMGVEAGVS
AGVVLSILLHLYKSSRPHIAEVGRVPGTEHFRNILRHEVETHPGLLTLRVDESLFFANAR
FLEDCIHRRVADDPQIDHVVLQCSAINDIDLSALESLEEIMHRLSEMGVMLHLSEVKGPV
MDRLRRGALLDHLTGKVFLSQHDAVEALRPAGGETRLSVPSLGG