Protein Info for PGA1_c19670 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome d ubiquinol oxidase subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 406 to 431 (26 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 10 to 438 (429 residues), 553.4 bits, see alignment E=1.4e-170

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 83% identity to pin:Ping_1787)

MetaCyc: 59% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXT0 at UniProt or InterPro

Protein Sequence (474 amino acids)

>PGA1_c19670 cytochrome d ubiquinol oxidase subunit 1 (Phaeobacter inhibens DSM 17395)
MFDGLTAETLARMQFAFTVSFHIIFPAFSIGLASYLAVLNAQWLRTRDETYYTLFEYWKK
IFAVAFGMGVVSGIVMSYQFGTNWSVFSDKTGPVLGPLMAYEVLSAFFLEAGFLGIMLFG
RARVGDRLHMFATAMVAFGTLMSATWILSVNSWMQTPAGYSINEVGQFVPEDWWQIVFNP
SFPYRLVHMVLAAFLTTALVVGGVGALHLLRDKTDAAARRMFSMAMWMLVVVAPMQIFAG
DMHGLNTLEHQPAKVMAMEGHYDSHPEGAPLILFGLPNAETKTIDYAIEIPKLSSLILKH
DLNAPLAGLDTIPDADEPPVAIVFWSFRVMVGLGFAMAGLGLWSLWGRLRGRLHDSRWLH
RASIAMGPMGFVAVLAGWITTEVGRQPFTVYGLLRTSDSLAPVSAPAVAASLTAFVIVYF
FIFGAGTFYILRMMNKAPATRNLGLRDGPVRAAGITPAQQVDRDITDDPTPQGN