Protein Info for PGA1_c19500 in Phaeobacter inhibens DSM 17395

Annotation: putative sugar-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 39 to 318 (280 residues), 95.9 bits, see alignment E=4.6e-31 PF13416: SBP_bac_8" amino acids 65 to 349 (285 residues), 68.3 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 49% identity to bph:Bphy_5435)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRE5 at UniProt or InterPro

Protein Sequence (414 amino acids)

>PGA1_c19500 putative sugar-binding periplasmic protein (Phaeobacter inhibens DSM 17395)
MNFKSNLLAGVATLAMTSAATADGIRAEVIHWWVSAGEAAAIKVFADAYTANGGEWIDNG
IGGGGAKTTFVNRLMGGDAPQVGQFNTSREFEEIVDAGLLHSLDAEAEAGNWSALFPGII
DNVVKRDGSYYAVPVNIHGSNWLWHNNQVMADAGLDVPTDWDSFFEAAETLKEAGIIPLA
VGGEAWQERLTFNSVLLSVGGQDLYLRLFEEKDTTALTSDEMKEVFDVYSRLRTLVRETD
PGSPGRSWNDATNMVITGQAAMQIMGDWAKGEFLSAGMTPGVEYGCTPAVIAGSPYMISG
DVFVFPKTGNEEDREAQSLMATTMLDAEVQVAFNNIKGSIPVRPDVDTSQLDVCGQQAIA
LTSNPDTHVGVTQMYISSDLAGALQDVYTQFWNSETMTTEEAITLLSQAYEIAG