Protein Info for PGA1_c19490 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, inner-membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 280 (197 residues), 48.8 bits, see alignment E=3.6e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 59% identity to rhi:NGR_c06680)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F073 at UniProt or InterPro

Protein Sequence (294 amino acids)

>PGA1_c19490 ABC transporter, inner-membrane protein (Phaeobacter inhibens DSM 17395)
MKTYLRSSKFVARLAITPFVVIVLLIFVGCVGWSVQLSFTNSKLLPNGDFVGLDQYYRLF
RTTRWIVSLKNMLLFGVFFVSGALILGFLLAILLDQKIRAEAFFRTIFLYPYSLSFVVTG
LAWQWFLNPSLGLQNAVRELGWSSFTFDWLTDQSMAIYTIVIAAIWHGSGLVMALMLAGL
RGVDPEIWRASKIDGIPTWRVYVHIVAPILGPVIFASVVLLSLSVVKGFDIVVAMTNGGP
GIATEVPAKFVLDHILERANVGLAMAGATIMLITVISALAPWLYVQHMRKRNSP