Protein Info for PGA1_c19480 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, inner-membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 289 (185 residues), 56.9 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 62% identity to rfr:Rfer_1108)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E1L6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PGA1_c19480 ABC transporter, inner-membrane protein (Phaeobacter inhibens DSM 17395)
MTNFDTIAASGPKPTRRSMRRIAIYVFLSVAAAFFLMPIYIVIVTSLKTMPEIRLGNVLQ
WPQTWSVDAWIKAWDTACTGLQCEGIKVGFWNSMRILLPSLVVSITAGALCGYILTFWTF
RGAEIFFAILLFGAFVPYQALIFPMIRIFSATGLYGTLPGIVLVHTIFGLPIMTLIFRNY
YSTLPSEIFKAARVDGAGFFSVFWYVLLPISTPIIVVAAILQVTGIWNDYLLGLIFGGRE
NMPMTVQLNNIVNSVRGGKEYNVNMAATLLTALVPLTVYFVSGRWFVRGIAAGAVKG