Protein Info for PGA1_c19470 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 28 to 170 (143 residues), 120.7 bits, see alignment E=1.4e-38 PF17912: OB_MalK" amino acids 246 to 294 (49 residues), 43.8 bits, see alignment 7.8e-15 PF08402: TOBE_2" amino acids 287 to 355 (69 residues), 28.3 bits, see alignment E=3.2e-10

Best Hits

Swiss-Prot: 48% identical to UGPC_BORA1: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Bordetella avium (strain 197N)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EMZ2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PGA1_c19470 ABC transporter, ATP-binding protein (Phaeobacter inhibens DSM 17395)
MKQVKIETMTSHVSARDLSVRFGAVEVLKSLNLDIQKGEFLVLLGASGCGKSTLLNTIAG
LQEATEGQIWINDENVTWREPKDRGLAMVFQSYALYPKMTVRGNLAFGLRMNKVPKAEAD
KLVDEAARVLQLEELLDRRPGELSGGQRQRVAIGRALVRKVDVFLFDEPLSNLDAKLRAE
LRVELKRLHQELGATMIYVTHDQVEALTLADRIAVMKDGVVQQLDSPEEIYRRPANRYVA
QFVGLPSMNFVNGVVTESGAIQTEDFELALDQCNLASTPAPGTEVEIGIRPEHVHPANAG
GFMLDVGMVELLGSERLIWGKVGNTSIVMRDDPDTTIRSGDQVRINLKPGAFSVFSAKTG
LRI