Protein Info for PGA1_c01950 in Phaeobacter inhibens DSM 17395

Annotation: ribosomal large subunit pseudouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR00005: pseudouridine synthase, RluA family" amino acids 7 to 323 (317 residues), 213.2 bits, see alignment E=2.5e-67 PF01479: S4" amino acids 11 to 57 (47 residues), 27.6 bits, see alignment 2e-10 PF00849: PseudoU_synth_2" amino acids 96 to 256 (161 residues), 109.7 bits, see alignment E=1.7e-35

Best Hits

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 83% identity to sit:TM1040_0291)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EII9 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PGA1_c01950 ribosomal large subunit pseudouridine synthase C (Phaeobacter inhibens DSM 17395)
MITVSEDDADQRIDRWLRRLFPHVSQGRIEKMCRKGELRLDGGRVKANSRVAAGQVVRVP
PLGASDLKPAEAPSYRISEADAKMIRGCVIYKDDAVIVLNKPAGLAVQGGSGTTKHVDGL
SAALQFDAEEKPRLVHRLDKDTSGVLVLARTRLAAQSLTAAFRHRATRKIYWALVAGVPT
PYLGEIKCGLVKAPGHGKSGEGEKMIAIHSNEVDSTPGAKRSHTHYATLYRVASRAAWVA
MEPITGRTHQLRAHMAEIGHPIAGDGKYGGSSQENLGDGWGAQLGGIISKKLHLHCRRMA
FEHPTTKKPLSITAPLPDHMKDSWDTFGWSEDLAAEDPFESLQ