Protein Info for PGA1_c19370 in Phaeobacter inhibens DSM 17395

Annotation: 4-hydroxy-2-oxovalerate aldolase BphF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 225 to 246 (22 residues), see Phobius details PF03328: HpcH_HpaI" amino acids 32 to 244 (213 residues), 141.7 bits, see alignment E=1.1e-45

Best Hits

Swiss-Prot: 47% identical to BPHF_RHOJR: 4-hydroxy-2-oxovalerate aldolase (bphF) from Rhodococcus jostii (strain RHA1)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 70% identity to jan:Jann_4135)

MetaCyc: 45% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52 or 4.1.2.n4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F063 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PGA1_c19370 4-hydroxy-2-oxovalerate aldolase BphF (Phaeobacter inhibens DSM 17395)
MQNPKNRFKSAIANGTRQLGVWNTIGGNTVPELLGGAGFEWVLVDCEHAAIETIEVLPAL
QAIGQNPDTSAVVRVAANDATLFKRVLDMGAQNVMVPYVQTAREAAAAVHAMRYGPHGMR
GMAGMTRATRYGKVDDYFDVAEDELCLIVQVETQTGLENLDAIAGTDGVDAVFIGPADLS
ASMGLRGQMTHPDVDKAVSNAINRLGEMGVPAGVMALDPDIADRYLALGATFVAVAVDLV
VLADAVSNIRNRFT