Protein Info for Psest_1942 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF01882: DUF58" amino acids 64 to 279 (216 residues), 138.8 bits, see alignment E=7.8e-45

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_2395)

Predicted SEED Role

"hypothetical protein PA3071"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKJ5 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Psest_1942 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) (Pseudomonas stutzeri RCH2)
MQAQASGSGQPSEQHTGIQVSLAELIDMRHRVREVPIFSTPHRRSPLVGLHHSKLRGRGV
DFDQVRVYQAGDDVRTIDWRVTARTQEPHTKLFHEERERPIYIVVEQSPRLFFGSGRLFK
SVLAAQAAALIGWAALSHNDRVGGLVFGSEQQEIKPRRSKQSLLQLLDRVTQANNRLHPE
SPLDPEAFSMALRRTREVLRPGSLSVILCDERTLTDAAEQQLSLLARHVDLLLLPLFDPL
DRALPAAGLLRFSEGNARLELDTHDAALRQRYRELGEARSARWQRLANRLRVPLMPLDTQ
DDLVEQLREHLSVRHPSARP