Protein Info for HP15_1858 in Marinobacter adhaerens HP15

Annotation: peptidoglycan-binding domain 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 285 to 304 (20 residues), see Phobius details PF13191: AAA_16" amino acids 22 to 156 (135 residues), 40.7 bits, see alignment E=7.6e-14 PF13401: AAA_22" amino acids 42 to 171 (130 residues), 98.1 bits, see alignment E=1e-31 PF05621: TniB" amino acids 46 to 183 (138 residues), 25.4 bits, see alignment E=1.8e-09

Best Hits

Predicted SEED Role

"General secretion pathway protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPD5 at UniProt or InterPro

Protein Sequence (568 amino acids)

>HP15_1858 peptidoglycan-binding domain 1 protein (Marinobacter adhaerens HP15)
MYYDFFGFREPPFSIAPDPRYLYLSDRHKEALAHLMYGVQGQGGFIVITGEVGTGKTTVS
RCFIENVPDHVDIALILNPRLSARELLSSICDELEIPHDISATIKELVDLINRDLLKAHA
AGRHKVLMIDEAQNLSAEVLEQLRLLTNLETAEKKLLQIVLLGQPELQEMLALPELRQLN
QRVTARYHLDAIGRDELAAYLKYRLSVAGMRGDIFSQRAVNRLYRESQGIPRLINLISDR
ALLGAYAEGEHEITPEHIRQAAKEVRGQSLGPTPSRAHQSPDRSQYLIVAASILVAIIGT
SWLFERWSPGGAFLTDPSSAEPLQGAVERVEEQEQKPLQEIQETGSGESSAPVELAVPGQ
LLDSVEAFQVLFGIWGREYEPSEAPVACDWANEEGLGCLSRQGSRRSLEFLDRPAMLQLQ
DEAGNRGFVVLRHLDGDTADIALPSGNQTVLFASIERYWFGEYRVLWRLPEYLTGDGFYS
NGGGEQLWIGARMMDLADRFSNSRAESDRVKRLDSEEQVRWYQSLRGLTVDGIAGAMTII
QINNDLEANIPRLKPLQSEGRRQVEGRE