Protein Info for Psest_0191 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 169 to 193 (25 residues), see Phobius details PF16767: KinB_sensor" amino acids 39 to 160 (122 residues), 142.8 bits, see alignment E=2.9e-45 PF00672: HAMP" amino acids 193 to 244 (52 residues), 37.3 bits, see alignment 1.1e-12 TIGR00229: PAS domain S-box protein" amino acids 257 to 374 (118 residues), 36.9 bits, see alignment E=1.8e-13 PF13188: PAS_8" amino acids 258 to 312 (55 residues), 29.8 bits, see alignment 1.6e-10 PF00989: PAS" amino acids 259 to 366 (108 residues), 33.7 bits, see alignment E=1.2e-11 PF13596: PAS_10" amino acids 260 to 367 (108 residues), 22.9 bits, see alignment E=4.5e-08 PF08448: PAS_4" amino acids 264 to 370 (107 residues), 53.7 bits, see alignment E=9.3e-18 PF00512: HisKA" amino acids 376 to 443 (68 residues), 60.5 bits, see alignment E=5.5e-20 PF02518: HATPase_c" amino acids 490 to 594 (105 residues), 96.6 bits, see alignment E=5.2e-31

Best Hits

KEGG orthology group: K11383, two-component system, NtrC family, sensor histidine kinase KinB [EC: 2.7.13.3] (inferred from 93% identity to psa:PST_4054)

Predicted SEED Role

"Sensory box histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGB4 at UniProt or InterPro

Protein Sequence (595 amino acids)

>Psest_0191 PAS domain S-box (Pseudomonas stutzeri RCH2)
MKLQMKLRTRLFLGFSALMTVALLGLLLALVSVMQMAKSQEQLIRNNFSIIEINQQLRQA
LGNHLIVMLAEDHNLDALDAVRQTFQQTLERGIAEASDDTDRQAFQAVASAYARFIEELD
AARHQSWTLLEDNSLSQAFNQVRSLMSDMQRAAYDKIRDTELRSRDRASLLAGLLGLTAI
AVLLIGFITAHSFARRFGEPIERLSAAADQIGRGDFNISLPTPPIAELSSLSRRFGLMAQ
ALHEFKQTNVEALVNGQQRLQALLDSIDDGLLIIDRDGRLEHANPVAQRQLAWENEHLGS
TLGEALGHPELDNAARQVLDDKSLSDPPEDLIIEADGERRLLAWRISPVSHHDGSISGAV
MVLHDVTDQRTFERVRNEFVLRASHELRTPVTGMQMAFSLLRERLRYPAGSRESDLFDTV
HEEMQRLVRLINDLLNFSRYQSGQQKLELEQCDIPELLEAARQRFEVAANEQDVQLKLEL
QQPLPTLMLDRQQIERVMDNLLSNALRHTPKGGEVRLLARHHGERMILSVEDNGEGIPYS
QQARIFEPFVQIGRRRGGAGLGLALCKEIAQLHGGRIGVHSRIGHGTIFYVALPI