Protein Info for PGA1_c00190 in Phaeobacter inhibens DSM 17395

Annotation: lysE type translocator-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 152 to 185 (34 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details PF01810: LysE" amino acids 21 to 211 (191 residues), 104.6 bits, see alignment E=2.5e-34

Best Hits

KEGG orthology group: None (inferred from 72% identity to jan:Jann_0418)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESZ8 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PGA1_c00190 lysE type translocator-like protein (Phaeobacter inhibens DSM 17395)
MEQFYTYLPGILLAYSAFLLGVSSPGPNVLAVIGTSMSVSRKAGVSLALGVASGSFTWAM
LTALGLSALLATYASAITVIKIVGGLYLLFLAYKAFKSAASAHDIQARTLDGKTRSPFGY
ALSGYIIQMTNPKAALTWIAIIALGLQPGAPLWVAAVIVIGTFMLSIVIHVLYAVAFSTP
IMVALYGKARRYIQATLGCFFAFAGVKLLTSRS