Protein Info for PGA1_c19230 in Phaeobacter inhibens DSM 17395

Annotation: tRNA-dihydrouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00742: tRNA dihydrouridine synthase A" amino acids 13 to 329 (317 residues), 409.7 bits, see alignment E=4.6e-127 PF01207: Dus" amino acids 17 to 322 (306 residues), 268.6 bits, see alignment E=3.4e-84

Best Hits

Swiss-Prot: 59% identical to DUSA_ECO57: tRNA-dihydrouridine(20/20a) synthase (dusA) from Escherichia coli O157:H7

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 77% identity to sil:SPO2374)

MetaCyc: 59% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXP6 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PGA1_c19230 tRNA-dihydrouridine synthase A (Phaeobacter inhibens DSM 17395)
MEKAVKSQIGVSRRLSVAPMMDWTDRHCRYLHRLLSNEALLYTEMVTSPALVRGGALHLL
DHSPQEHPVALQLGGSDPAELAQAAAFGAEAGYDEINLNCGCPSDRVQSGAFGAVLMKSP
DLVAECVAAMRAKVDVEVTVKCRIGVDDQDPQEVLPVFLERIAAAGCERVTIHARKAWLK
GLSPKENRDIPPLDYEIVHQMKAEFPQLHISLNGGVASLDEALPHLERGLDGVMIGRAAY
HQPSDILSQADPLIFGTGSATDPVAVVGHMLGYIDDQMAQGARLHQITRHMLGLFAGRPG
ARNWRRVLSEGASRPGADTRLVETALEQVTGIAA