Protein Info for PGA1_c19110 in Phaeobacter inhibens DSM 17395

Annotation: superoxide dismutase SodB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 89 (87 residues), 80.9 bits, E=7.6e-27
• PF02777: Sod_Fe_C
  • amino acids 98 to 198 (101 residues), 121 bits, E=2.1e-39

Best Hits

Swiss-Prot: 88% identical to SODF_RHOCA: Superoxide dismutase [Fe] (sodB) from Rhodobacter capsulatus

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 94% identity to sit:TM1040_0976)

MetaCyc: 49% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• superoxide radicals degradation (2/2 steps found)
• reactive oxygen species degradation (3/4 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See I7F040 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PGA1_c19110 superoxide dismutase SodB (Phaeobacter inhibens DSM 17395)
MAFELPDLPYAHDALASKGMSAETLEYHHDLHHKAYVDNGNKLIAGTEWDGKSMEEIIKG
TYDANAVAQSGIFNNISQLWNHNQFWEMMGPGESKMPGELEKALVDSFGSVDTFKEEFSA
AGAGQFGSGWAWLVKDTDGGLKVTKTENGVNPVCFGQTALLGCDVWEHSYYIDFRNKRPA
YLTNFLDNLVNWENVASRM