Protein Info for PGA1_c19080 in Phaeobacter inhibens DSM 17395

Annotation: TIGR00730 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR00730: TIGR00730 family protein" amino acids 5 to 178 (174 residues), 183.2 bits, see alignment E=1.8e-58 PF18306: LDcluster4" amino acids 11 to 122 (112 residues), 64.5 bits, see alignment E=9.1e-22 PF03641: Lysine_decarbox" amino acids 48 to 177 (130 residues), 134 bits, see alignment E=3.8e-43

Best Hits

Swiss-Prot: 46% identical to LOGH_PSEAE: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (PA4923) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06966, (no description) (inferred from 74% identity to sit:TM1040_0978)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXN1 at UniProt or InterPro

Protein Sequence (180 amino acids)

>PGA1_c19080 TIGR00730 family protein (Phaeobacter inhibens DSM 17395)
MRIHSVCVYCGSRDGVRPAYADAAEALGTGLATQGQRLVYGAGDVGLMGRVARAAQAAGG
RTFGVIPEHLVRREVAKTDLNTYVVTETMHERKKVMLYNADAVVVLPGGAGSLDELFEAL
TWRQLELHGKPILILNIYGYWDPLKALVEHVVAEGFAGAETAAALTWVSNVDDALESLRG