Protein Info for HP15_1833 in Marinobacter adhaerens HP15

Annotation: isopropylmalate isomerase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 1 to 194 (194 residues), 275.4 bits, see alignment E=1.2e-86 PF00694: Aconitase_C" amino acids 1 to 132 (132 residues), 136.4 bits, see alignment E=1.1e-43 PF27512: LeuD" amino acids 136 to 173 (38 residues), 62.6 bits, see alignment 3.6e-21 PF27434: LeuD_C" amino acids 185 to 213 (29 residues), 41.4 bits, see alignment 1.1e-14

Best Hits

Swiss-Prot: 89% identical to LEUD_MARHV: 3-isopropylmalate dehydratase small subunit (leuD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 89% identity to maq:Maqu_1564)

MetaCyc: 61% identical to maleate hydratase small subunit (Pseudomonas alcaligenes NCIMB 9867)
Maleate hydratase. [EC: 4.2.1.31]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.31 or 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPB0 at UniProt or InterPro

Protein Sequence (215 amino acids)

>HP15_1833 isopropylmalate isomerase small subunit (Marinobacter adhaerens HP15)
MRALKQHQGVVAPMDRSNVDTDMIIPKQFLKSIKRTGFGPNLFDELRYMDEGKPDQDCST
RPINPDFVLNQDRYKNASVLLARRNFGCGSSREHAPWALEDFGFRVIIAPSFADIFYNNC
FKNGLLPIVLPEEIVDRLFREVEQSEGYQLAVDLEARTVTTPSGETFTFEVDDFRRHCLL
NGLDDIGVTLEDAELIRSYEESRRKTAPWLFGAGG