Protein Info for PGA1_c19030 in Phaeobacter inhibens DSM 17395

Annotation: putative efflux transporter, RND family, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 92 to 422 (331 residues), 133.3 bits, see alignment E=4.8e-43 PF16576: HlyD_D23" amino acids 208 to 343 (136 residues), 63.2 bits, see alignment E=2.2e-21 PF13437: HlyD_3" amino acids 242 to 337 (96 residues), 57.4 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: None (inferred from 69% identity to sit:TM1040_0988)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXM7 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PGA1_c19030 putative efflux transporter, RND family, MFP subunit (Phaeobacter inhibens DSM 17395)
MRVIPLMTAAVVTAGLYYAVIERDALLAFARGEQVSDETASSDVSEPTDASATTAAASET
VAPQAAGADKADNSGVRVVALRSTARGIDSAVVLRGQTQAIRQVEVRSETTSTVLSEPLR
KGAQVKAGDLLCKLDPGTRPSTLLEAKARLSEAKIRVPEARARLDESRARLKEAQINLTA
AAKLSEGGFASETRLASSQAAERSAVAGVATAETGLETTSAGIEAASAQVAAAEKELARL
DILAPFDGLLESDTAELGSLMQPGSLCATVIQLETIKLVGYVPETEVNRVTIGAGARAEL
ANGRNVEGKVTFISRSADPTTRTFEVEITVPNPDLAIRDGQTADIVISAEGSKAHYLPQS
ALTLNNDGQLGVRVVEDDMTVGFYPIQLLRDEASGVWLGGLPEQADVIVVGQDFVVAGVS
VAPTYKEVSQ