Protein Info for PGA1_c18990 in Phaeobacter inhibens DSM 17395

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR00231: small GTP-binding protein domain" amino acids 4 to 122 (119 residues), 69.3 bits, see alignment E=5.1e-23 amino acids 200 to 364 (165 residues), 89.3 bits, see alignment E=3.6e-29 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 458 (455 residues), 536.7 bits, see alignment E=6.9e-165 PF02421: FeoB_N" amino acids 4 to 93 (90 residues), 41.6 bits, see alignment E=5.6e-14 amino acids 202 to 368 (167 residues), 43.3 bits, see alignment E=1.7e-14 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 93.8 bits, see alignment E=4.6e-30 amino acids 202 to 320 (119 residues), 78.2 bits, see alignment E=3.2e-25 PF00009: GTP_EFTU" amino acids 201 to 370 (170 residues), 38.5 bits, see alignment E=5.8e-13 PF00350: Dynamin_N" amino acids 203 to 257 (55 residues), 29.1 bits, see alignment 5.6e-10 PF14714: KH_dom-like" amino acids 378 to 458 (81 residues), 108.5 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 87% identical to DER_RUEST: GTPase Der (der) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03977, GTP-binding protein (inferred from 87% identity to sit:TM1040_0991)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E1H3 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PGA1_c18990 GTP-binding protein EngA (Phaeobacter inhibens DSM 17395)
MSFTLAIVGRPNVGKSTLFNRLVGKRLALVDDQPGVTRDLREGEARLGDLRFTVVDTAGL
EDATDNSLEGRMRRLTERAVDMADVCLFMIDARVGVTPIDQMFAEILRKKSAHVILAANK
AEGNAADAGVLDAWGLGLGEPIRLSGEHGEGLNDLYSQLMPLADEFEERAKDDSPEIDVA
LDEDDDEEDLSVPMPTRNKPLQVAVVGRPNAGKSTLINKILGEDRLLTGPEAGITRDAIS
LQIDWQDVPMRIFDTAGMRKKAKVQEKLEKLSVSDGLRAVKFAEVVVVLLDAAIPFEQQD
LRIADLAEREGRAVVVAVNKWDIEDEKQEKLRNLKEAFDRLLPQLRGAPLITVSAKTGKG
LDRLHAAIMRAYDVWNRRVPTAALNRWLTGMLEQHPPPAPQGKRIKLRYMTQAKTRPPGF
VVMCSHPDKMPESYNRYLVNGLRQDFDMPGSPIRLTLRSQSDKNPYKGKKKAPPSKLRKH
LEGRRN