Protein Info for Psest_1905 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein, contains double-stranded beta-helix domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 88% identical to MTND_PSEU5: Acireductone dioxygenase (mtnD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 88% identity to psa:PST_2431)

MetaCyc: 56% identical to acireductone dioxygenase (Klebsiella oxytoca)
Acireductone dioxygenase (Fe(2+)-requiring). [EC: 1.13.11.54]; Acireductone dioxygenase (Ni(2+)-requiring). [EC: 1.13.11.54, 1.13.11.53]

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

3-methylthiopropanoate biosynthesis (1/1 steps found)
L-methionine salvage cycle III (6/11 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (3/7 steps found)
L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKE0 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Psest_1905 Uncharacterized conserved protein, contains double-stranded beta-helix domain (Pseudomonas stutzeri RCH2)
MSVLSVYHETRPDQPLKVLTHLEDIAPTLAKVGVQVERWEANAPIAAGASQEEVIAAYRP
QIDKLMTERGYVTVDVISVTRDHPQKDELRAKFLDEHRHAEDEVRFFVAGRALFSLHIED
MVYAVLCEKNDLISVPAGTRHWFDMGEEPHFVAIRLFKNPEGWVAEYTGESIADQFPRLD
D