Protein Info for PGA1_c18880 in Phaeobacter inhibens DSM 17395
Annotation: heme exporter protein B
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to CCMB_RHOCB: Heme exporter protein B (helB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
KEGG orthology group: K02194, heme exporter protein B (inferred from 90% identity to sil:SPO2316)MetaCyc: 46% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408
Predicted SEED Role
"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes
MetaCyc Pathways
- cytochrome c biogenesis (system I type) (6/11 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7E1G6 at UniProt or InterPro
Protein Sequence (218 amino acids)
>PGA1_c18880 heme exporter protein B (Phaeobacter inhibens DSM 17395) MRALLLRDLRLTLRAGGGFGLGLAFFLIVTVLVPFSVGPQSELLGRIAPGVLWLGALLAC LLSLDRLLALDWEDGTLDLMATAPLPLEAVVTIKALAHWITTSLPLVLAAPVLGVLLNLP TAGFLWLVVSLLLGTPALSVIGTFGAALTVGLKRGGLLMSLLVLPLYVPTLIFGAEAARR GAAGMAVETPLLMLAGISAATLALLPFASAAVLRVNLR