Protein Info for Psest_1898 in Pseudomonas stutzeri RCH2

Annotation: ABC-type sugar transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 265 (173 residues), 54.8 bits, see alignment E=5.3e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 97% identity to psa:PST_2438)

Predicted SEED Role

"Glucose ABC transport system, inner membrane component 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM87 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psest_1898 ABC-type sugar transport system, permease component (Pseudomonas stutzeri RCH2)
MSDFAQPRLTLGRLTIYATLLLACAVYLVPLIVMLLTSFKTPEDIRTGNLLSWPEAFSAM
GWLTAWDSIGGYFWNSVKIVIPAVLISTALGALNGYVLSMWRFRGSQLFFGLLLFGCFLP
FQVILLPASFTLGKLGLANTTTGLVLVHVVYGLAFTTLFFRNFYVSVPDALVRAARLDGA
GFFTIFGRILLPMSVPIIMVCLIWQFTQIWNDFLFGVVFASGDTQPVTVALNNLVNTSTG
AKQYNVDMAAAMIAGLPTLVVYVVAGKYFLRGLTAGAVKG