Protein Info for Psest_1897 in Pseudomonas stutzeri RCH2

Annotation: ABC-type sugar transport systems, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 296 (201 residues), 49.1 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 38% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to psa:PST_2439)

Predicted SEED Role

"Glucose ABC transport system, inner membrane component 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI61 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_1897 ABC-type sugar transport systems, permease components (Pseudomonas stutzeri RCH2)
MSSIALQARPAKASPLDALQRWLPKLVLAPSMLIVLVGFYAYIGWTFLLSFTNSRFMPSY
KWVGLQQYERLWDNDRWWVASQNLLVFGGLFIAVSLIIGVVLAVLLDQRIRREGLIRTIY
LYPMALSMIVTGTAWQWLLNPGLGLDKLLRDWGWEGFRFDWLVDPDRVIYCLVIAAVWQA
SGFVMALFLAGLRSVDQSIIRAAQVDGASLPTIYLRIVLPSLRPVFFSALMILAHIAIKS
FDLVAAMTAGGPGYSSDLPAMFMYAHTFTRGQMGLGAASAMLMLGAVMAIIVPYLYSELR
NKRHV