Protein Info for PGA1_c18860 in Phaeobacter inhibens DSM 17395
Annotation: thiol:disulfide interchange protein CcmG
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to HELX_RHOCB: Thiol:disulfide interchange protein HelX (helX) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 71% identity to sil:SPO2314)MetaCyc: 44% identical to thiol:disulfide oxidoreductase CcmG (Escherichia coli K-12 substr. MG1655)
1.8.4.-; RXN-21424; RXN-21425
Predicted SEED Role
"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange
MetaCyc Pathways
- cytochrome c biogenesis (system I type) (6/11 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DR82 at UniProt or InterPro
Protein Sequence (179 amino acids)
>PGA1_c18860 thiol:disulfide interchange protein CcmG (Phaeobacter inhibens DSM 17395) MTKISPVMALPVLVFGGLVALFLAGMFRNDPESLPSAREGQTAPPVVLTSFADDPGFDDA TLRDGTVKLVNFWASWCGPCRVEHPSLDALSEEGLAIYGVNYKDQEDNAVGFLEELGNPY RAIGRDEAGRMALDWGVYGVPETYVIDGKGTIILRFAGPITQRVIDTTIGPALEKAAGK