Protein Info for Psest_1889 in Pseudomonas stutzeri RCH2

Annotation: tryptophanyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR00233: tryptophan--tRNA ligase" amino acids 7 to 195 (189 residues), 192.3 bits, see alignment E=6.6e-61 PF00579: tRNA-synt_1b" amino acids 8 to 174 (167 residues), 170.4 bits, see alignment E=2.8e-54 amino acids 248 to 353 (106 residues), 40.3 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 61% identical to SYW_RALSO: Tryptophan--tRNA ligase (trpS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01867, tryptophanyl-tRNA synthetase [EC: 6.1.1.2] (inferred from 94% identity to psa:PST_2447)

Predicted SEED Role

"Tryptophanyl-tRNA synthetase (EC 6.1.1.2)" (EC 6.1.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.2

Use Curated BLAST to search for 6.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM27 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Psest_1889 tryptophanyl-tRNA synthetase (Pseudomonas stutzeri RCH2)
MSSMDSQRRVVSGMRPSGRLHLGHYNGVLKNWVKLQHEYECFFCIVDWHALTTDYENSGE
ISQNIMDMAVDWLAAGVSPSSATLFIQSQVPEHAELHLLLSMISPLGWLERVPSYKELQQ
NLQHKDLDTYGFLGYPLLQAADILIYRAGLVPVGADQLPHIEFARDVARRFNHLYGREAD
FEDKAEAAIRKLGKKTSRLYVSLRKSYQEQGDVDALNTARAIIKEQQTITIGDQERLYGY
LEGCGKLLLPEPQALLGESPKISGLDGGKMAKSNSNAIYLRDTPNEIEEKIRRMPTDPAR
VHRSDPGEPTRCPVWQMHLVHSAQDVCQWAEQGCRSAGIGCLECKAPLIDSIKSDLAPLQ
ERALDYEQNPDLVRSILAEGAEHARDEARETLIEVRQAMGLNYR