Protein Info for Psest_1882 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 148 to 171 (24 residues), see Phobius details PF00672: HAMP" amino acids 167 to 222 (56 residues), 34.8 bits, see alignment 2.6e-12 PF00512: HisKA" amino acids 227 to 290 (64 residues), 46.2 bits, see alignment E=5.7e-16 PF02518: HATPase_c" amino acids 335 to 439 (105 residues), 84.8 bits, see alignment E=8.9e-28

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2454)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI47 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psest_1882 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MRSLFWRILATFWLAIALVAGLAMLLGHALNQDAWILGRHPALQGLAETWTEVYERQGPV
AAQRLLEQHRHRSRVDVQVLAENGQPIIRGTFPARAAAFEARHQNRERQLPWRRLTADYT
SPTSGETYLFIYRIPHPELQAWHRGSLAWPLSALGIALVVLTGFSLLLTLSITRPLDRLR
RAVHDLGQTSYQQQSLARLATRRDELGLLASDFNRMGARLQALISSQRQLLRDVSHELRS
PLARLRIAQALAERASPSEREVIWPRLAKECDRLEALISEILELSRLDAEPGTATGVDLP
AMFEQLEDNARIIAPNQRIDSRVQPGLRLIGWTDMLERALDNLLRNALRFNPEGVPVELH
AQREGNEVVLSVRDHGPGVADEHLPQLSEPFFRAPGQTAAGHGLGLAIARRAAERHGGQL
ELSNHPDGGFVASLRLPLADDSAQGQSL