Protein Info for HP15_1799 in Marinobacter adhaerens HP15

Annotation: sterol-binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF14864: Alkyl_sulf_C" amino acids 1 to 101 (101 residues), 44.5 bits, see alignment E=1.8e-15 PF02036: SCP2" amino acids 7 to 102 (96 residues), 73.3 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: None (inferred from 97% identity to maq:Maqu_1531)

Predicted SEED Role

"SCP-2 sterol transfer family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNR9 at UniProt or InterPro

Protein Sequence (104 amino acids)

>HP15_1799 sterol-binding domain protein (Marinobacter adhaerens HP15)
MSVAQVFEQLEQNFNADAAQGLDLVFQFDIEDDKTYHLVINDGTCKMHEGAHDDPSVTLI
MNSETLQGIVSGETDGMQAFMAGQLRAEGDMMLATKLGELFKMG