Protein Info for Psest_1879 in Pseudomonas stutzeri RCH2

Annotation: Trk-type K+ transport systems, membrane components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 456 to 481 (26 residues), see Phobius details PF02386: TrkH" amino acids 41 to 476 (436 residues), 196.1 bits, see alignment E=4.4e-62

Best Hits

Swiss-Prot: 57% identical to TRKI_HALED: Trk system potassium uptake protein TrkI (trkI) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 97% identity to psa:PST_2457)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM13 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Psest_1879 Trk-type K+ transport systems, membrane components (Pseudomonas stutzeri RCH2)
MALPTLRIIGFILGIFLITLAVSMIIPMLTLLAFERTDDLQAFIWGSLITFSCGFALVAP
GRPANTNLRPRDMYFLTTISWVVVCCFAALPLMLIQHISYSDAFFETMSGITTTGATVLS
GLDSASPGLLMWRSLLHWLGGIGFIGMAIAILPLLRVGGMRLFQTESSDWSEKVMPRSHV
AGQYLLVIYVTFTIAAFVAFLLTGMSIFDAINHAMSTVATGGFSTSDASMGKFGPSAHWV
AIFFMLLGSLPFTLYVMTLRGHHTALFRDQQVRGFVMMLAITSLLFSGWYWLNNDIPALD
ALRIVTFSVVSVVTTTGFAVDDYTQWGGFAVMAFFYLTFVGGCSGSTSGGLKMFRFQVAY
SLLRANFKQLIHPRAVIRQQYNGHNLDEEIVRSILTFSFFITMTIGVLALCLALLGLDPI
TALTGAATAVCNVGPGLGEIIGPAGNFSTLPDTAKWLLSIGMLLGRLEIITVLVLLTPAF
WRH