Protein Info for HP15_1795 in Marinobacter adhaerens HP15

Annotation: sulfite reductase hemoprotein, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF03460: NIR_SIR_ferr" amino acids 43 to 101 (59 residues), 63 bits, see alignment 1.7e-21 amino acids 336 to 387 (52 residues), 47.3 bits, see alignment 1.4e-16 PF01077: NIR_SIR" amino acids 109 to 265 (157 residues), 150.7 bits, see alignment E=2.4e-48 amino acids 399 to 538 (140 residues), 44.7 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: K00381, sulfite reductase (NADPH) hemoprotein beta-component [EC: 1.8.1.2] (inferred from 88% identity to maq:Maqu_1528)

Predicted SEED Role

"Sulfite reductase [NADPH] hemoprotein beta-component (EC 1.8.1.2)" in subsystem Cysteine Biosynthesis (EC 1.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNR5 at UniProt or InterPro

Protein Sequence (540 amino acids)

>HP15_1795 sulfite reductase hemoprotein, beta subunit (Marinobacter adhaerens HP15)
MAAERVAQFRDQTERALAGELAEDEFLPLRLQNGLYVQRLAPMLRICVPYGMMRSNQLRR
LARITRDYDKGYAHFTTRQNVQLNWPALEDVPDILAELAEVEMHANQTSGNCIRNTTTDQ
FSGVQSDEIADPRPYCEIIRQWSTFHPEFAFLPRKFKVAVNASEQTDRAAIQVHDIGLQM
VRNEAGDLGFRVHVGGGLGRTPMVGPVIRDFLPELDLLTYLEAVLRVYNRYGRRDNKFKA
RIKILVKALTPEGFAEKVEAEWQHIKESPTRLTPEAIQRIQGYFTEPDYAAIDNATDLLA
SQRFENRGFDQWLTHNVDTHKKAGYAIVSLTMKKTGTPPGDVSDKQLEQIADLADEFSFG
EIRVTHQQNVVLADVRQDRLFELWQAITPMGFGTANLNTLTDVICCPGGDYCALANAKSI
PVAEAIQRQFDDLDYLYDLGNIDLNISGCMNACGHHHVGNIGVLGVDKKGQEFYQISLGG
SSHHDASIGKILGPSFARDEMPKVISKIIDVYVDKRTEEETFLDTYRRVGIDPFKERVYA