Protein Info for Psest_1870 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF12802: MarR_2" amino acids 30 to 90 (61 residues), 51.7 bits, see alignment E=1.2e-17 PF01047: MarR" amino acids 32 to 90 (59 residues), 38.2 bits, see alignment E=1.7e-13 PF13463: HTH_27" amino acids 33 to 96 (64 residues), 29.6 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 38% identical to SLYA_SODGM: Transcriptional regulator SlyA (slyA) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 99% identity to psa:PST_2466)

Predicted SEED Role

"Transcriptional regulator SlyA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKA1 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Psest_1870 Transcriptional regulators (Pseudomonas stutzeri RCH2)
MYAEQHRFAMQLAQLSRGWRAELDRRLADLGLSQARWLVLLHLARFDHEPTQRELAQSVA
VEGPTLARLLDSLEAQGLVHRKASAEDRRAKRISLGAPALPLIEKIEAISTQVRHEAFAG
IDEEDLRKCQQVHARILANLDKR