Protein Info for HP15_183 in Marinobacter adhaerens HP15

Annotation: copper-resistance protein, CopA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 18 to 566 (549 residues), 704.6 bits, see alignment E=5.1e-216 PF07732: Cu-oxidase_3" amino acids 34 to 138 (105 residues), 130.8 bits, see alignment E=4.1e-42 amino acids 455 to 567 (113 residues), 24.6 bits, see alignment E=3.3e-09 PF00394: Cu-oxidase" amino acids 221 to 318 (98 residues), 88.9 bits, see alignment E=6.1e-29 PF07731: Cu-oxidase_2" amino acids 449 to 566 (118 residues), 102.7 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: None (inferred from 90% identity to abo:ABO_1363)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK16 at UniProt or InterPro

Protein Sequence (586 amino acids)

>HP15_183 copper-resistance protein, CopA family (Marinobacter adhaerens HP15)
MKTRFLTGLLSLLMPALVMAGEYDLTVDRVKIDTGDFVKEGIGYNGASPGPVMRFKEGEN
VKINVTNNLDEMTSIHWHGLILPFNQDGVPGISFPGIKPGETFTYEFPIQQAGTYWFHSH
SGFQEPDGAYGAIVIEPEGREPFRYDREYVVQLTDKHPHSGDRIMRNLKMMPDYYNREQQ
TVGEFFSDVSKNGLMNTVSDRMAWGGMRMMKADVEDVQGFTGLINGKGPDQNWTGLFEPG
ERIRLRFINSSAMTYFDIRIPGLDMTVVQADGNNVQPVNVDEFRIGVAETYDVIVRPKDE
QAYTIFAESMGRSGYARATLAPEEGMEAAVPQLREPARLTMADMSGMHGMDHGSMAGMDH
GDMDMSSSEGMGGMDHSSMKGMDHSNMKGMDHSNMEGMDHGSMAMGKKEGPSDPFYAKGS
GLVPTAANGGKFLSYADLKAQDPLYEVREPTREIELRLTGNMERYTWSINGVKYEDADPI
RLKYGERVRFKFVNETMMTHPMHLHGMWSILDVGAGQWNPIKHTVSVQPGTTVYMETEVD
EPGQWAFHCHLSYHAAAGMFRKVIVEGGPESTQAKTDVAAEEGGEA