Protein Info for PGA1_c01860 in Phaeobacter inhibens DSM 17395

Annotation: preprotein translocase SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 398 to 416 (19 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 24 to 429 (406 residues), 419.9 bits, see alignment E=5.5e-130 PF00344: SecY" amino acids 81 to 418 (338 residues), 376.8 bits, see alignment E=4.7e-117

Best Hits

Swiss-Prot: 52% identical to SECY_RICBR: Protein translocase subunit SecY (secY) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 92% identity to sit:TM1040_0275)

MetaCyc: 50% identical to Sec translocon subunit SecY (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWW6 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PGA1_c01860 preprotein translocase SecY (Phaeobacter inhibens DSM 17395)
MVSAAEQMAANTSWAALGKATDLRNRILFTLGLLIVYRLGTYIPVPGIDADALRQFMTSA
GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI
NQYTRYGTVLLATAQAYGLAVSLESGDLATDPGMYFRLACMITLVGGTMFLMWLGEQITQ
RGIGNGISLIIFVGIIAEVPAAIAQFLASGRSGAISPAVIIAVILMMIAIIMFVVFMERA
LRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSAGSTSG
PIMSWLLANFGPGQPLYLLFFVGMIVFFAYFYTFNVSFKPDEVANNLKNQNGFVPGIRPG
KKTAEYLEYVVNRVLVLGSAYLAAVCLLPEILRGQLAIPVYFGGTSVLIVVSVVMDTIQQ
AQSHLLAHQYEGLIEKSQLRGRNKKRTRRGPARR