Protein Info for Psest_1849 in Pseudomonas stutzeri RCH2

Annotation: Predicted glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13230: GATase_4" amino acids 1 to 257 (257 residues), 350.2 bits, see alignment E=2.9e-109

Best Hits

KEGG orthology group: K07008, glutamine amidotransferase (inferred from 97% identity to psa:PST_2481)

Predicted SEED Role

"Glutamine amidotransferase, class-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLY0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psest_1849 Predicted glutamine amidotransferase (Pseudomonas stutzeri RCH2)
MCELLGMSANVPTDIVFSFTGLMQRGGKTGPHKDGWGIAFYEGRGLRLFQDPVASCESEV
AKMVQRYLIKSEVVIGHIRHANVGKVSLVNTHPFVRELWGQHWCFAHNGQLSDFEPPKGI
YRPVGDTDSERAFCDLLNRIRLDFPDRCAPESVLPVLLGACVEYRRKGVFNCLLSNGEWL
FSFCSTKLAEITRRAPFGPAQLRDAELTVNFHAETTPDDVVTVLATEPLTNNEQWTLHEP
GQWSLWRLGECIAQGKVTEC