Protein Info for Psest_1835 in Pseudomonas stutzeri RCH2

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 218 to 230 (13 residues), see Phobius details amino acids 250 to 261 (12 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details PF01943: Polysacc_synt" amino acids 16 to 269 (254 residues), 60.2 bits, see alignment E=2.2e-20 PF13440: Polysacc_synt_3" amino acids 24 to 319 (296 residues), 36.2 bits, see alignment E=4.1e-13

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_2496)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK60 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Psest_1835 Membrane protein involved in the export of O-antigen and teichoic acid (Pseudomonas stutzeri RCH2)
MRDHALMGVTTAARTAVQLGTLLILARTLGPSDFGFISIVITWSTIVALVTDYGFGMRAL
RDIGAERHRAGEIMSASLAAKSVLVLPACIVLLPIILFVLDLHTTERFAAVLFLLGTLAS
SYGDLGLTVFRSIGQFHRETKIVAATALVHFVLIGAAILLRNDVLAIGVAFLLSRLIYAT
FALRALSKILALGGILRSSWQVLGERFKSSTSFAIDSGATNIFAQLDVILVNHLAGREAA
GIYFAGSRLIQGAVPFSVLLASVHIPRFAYQLHNKTAGLIRYGARILGEYTGMGLIFALA
FFFIGPLFTDYFLGAEYAELNTLWLAFACFTAARFIAAGLGVQLLAMGTGFLRTFGIIAS
GVITVACYWIFIPSHGIQAAPWVSTLGMVVLTFIYGYAVLNIYRKQRQPA