Protein Info for Psest_1821 in Pseudomonas stutzeri RCH2

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 2 to 468 (467 residues), 771.1 bits, see alignment E=2e-236 PF00483: NTP_transferase" amino acids 4 to 286 (283 residues), 220.5 bits, see alignment E=5.3e-69 PF22640: ManC_GMP_beta-helix" amino acids 299 to 345 (47 residues), 61.7 bits, see alignment 1e-20 PF01050: MannoseP_isomer" amino acids 350 to 464 (115 residues), 200.7 bits, see alignment E=1.2e-63 PF07883: Cupin_2" amino acids 381 to 448 (68 residues), 44.9 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 66% identical to MANC_ECOLI: Mannose-1-phosphate guanylyltransferase (manC) from Escherichia coli (strain K12)

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 77% identity to pfs:PFLU3664)

MetaCyc: 66% identical to mannose-1-phosphate guanylyltransferase (Escherichia coli K-12 substr. MG1655)
Mannose-1-phosphate guanylyltransferase. [EC: 2.7.7.13]

Predicted SEED Role

"Mannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22)" in subsystem Alginate metabolism or Mannose Metabolism (EC 2.7.7.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.13, 2.7.7.22

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKQ2 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psest_1821 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (Pseudomonas stutzeri RCH2)
MLLPVIIAGGSGSRLWPLSRQLNPKQFLALTDAQLSMLQSTIRRLDGLEAGLPLLICNEQ
HRFLAAEQLRQLSMEQASILLEPVGRNTAPAIALAALQATQEGDDPILLVLAADHLIQDV
DAFHSSIQAAMPFATNGKLVTFGIVPTNPETGYGYIEKGKELGEGGFAVNRFVEKPSLDI
AEEYLASGEYFWNSGMFMFRASRYLDELERHQPSILAACRQALAAGTQDMHFVRVDAATF
AACPEDSVDYAVMEKTNDAVMVPLDAGWSDVGSWTALWEASNKDAEGNVFKGDVLGHATR
NSFVHADSRLVATLGVEDLVIVETKDAVLVAHKNQVQDVKKLVERIKADNRHEHLNHREV
YRPWGVYDAIDSGHRYQVKRITVQPGAKLSVQMHHHRAEHWVVVSGTAKVTNGDKTYLVT
ENQSTYIPVGQVHALENPGVIPLELIEVQSGSYLGEDDIVRFEDQYGRA