Protein Info for Psest_1818 in Pseudomonas stutzeri RCH2

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF04321: RmlD_sub_bind" amino acids 3 to 161 (159 residues), 30.1 bits, see alignment E=4e-11 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 3 to 351 (349 residues), 589.8 bits, see alignment E=8.5e-182 PF01370: Epimerase" amino acids 4 to 251 (248 residues), 266.4 bits, see alignment E=3.4e-83 PF16363: GDP_Man_Dehyd" amino acids 5 to 345 (341 residues), 522.5 bits, see alignment E=8.7e-161

Best Hits

Swiss-Prot: 88% identical to GM4D_VIBCL: GDP-mannose 4,6-dehydratase (gmd) from Vibrio cholerae

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 89% identity to pfv:Psefu_1689)

MetaCyc: 82% identical to GDP-mannose 4,6-dehydratase monomer (Escherichia coli O157:H7)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM06 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Psest_1818 GDP-mannose 4,6-dehydratase (Pseudomonas stutzeri RCH2)
MRKALITGITGQDGSYLAELLLEKGYEVHGIKRRASLFNTQRVDHLYQDPHVNNRNFVLH
YGDLSDSSNLTRIIQEVQPDEVYNLGAQSHVAVSFESPEYTADVDAMGTLRLLEAIRLLG
LEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKLYAYWITVNYREAYGMYACN
GILFNHESPRRGETFVTRKITRGLANIAQGLEQCLYMGNLDALRDWGHAKDYVRMQWMML
QQEQPEDFVIATGVQYSVREFIRWSAAELGITLKFEGQGVEELAIIEAIEGEKAPALKVG
DVVVRVDPRYFRPAEVETLLGDPTKAKDKLGWVPEITVQEMCAEMVREDLTAARRHALLK
QHGHDIPVPMEN