Protein Info for PGA1_c18040 in Phaeobacter inhibens DSM 17395

Annotation: Short-chain alcohol dehydrogenase of unknown specificity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01370: Epimerase" amino acids 3 to 98 (96 residues), 23.7 bits, see alignment E=7.6e-09 PF13561: adh_short_C2" amino acids 33 to 179 (147 residues), 62.4 bits, see alignment E=1.3e-20 PF00106: adh_short" amino acids 36 to 162 (127 residues), 41.2 bits, see alignment E=3.3e-14 PF08659: KR" amino acids 36 to 139 (104 residues), 24 bits, see alignment E=8.6e-09 PF23441: SDR" amino acids 44 to 186 (143 residues), 28.2 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: None (inferred from 68% identity to cps:CPS_2520)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EMK8 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PGA1_c18040 Short-chain alcohol dehydrogenase of unknown specificity (Phaeobacter inhibens DSM 17395)
MKILIVGATGLIGGAVANALSANHEIISAGYSDGDVKVDLGSKASIEAMFQAIGTVDAVI
STAGLAGFAPFNELDDAAYDLALGNKLMGQVNLVRVGRNHITEGGSFTLTAGILSRDPMP
GSVVISIANGALESFAKAVALELDRGLRVNTVSPVFVKETMEMMGMDSSSGLSAADTAKA
YVAAIEGAMSGKTLDAPDYV